USP22 Antikörper (N-Term)
-
- Target Alle USP22 Antikörper anzeigen
- USP22 (Ubiquitin Specific Peptidase 22 (USP22))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser USP22 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- USP22 antibody was raised against the N terminal of USP22
- Aufreinigung
- Affinity purified
- Immunogen
- USP22 antibody was raised using the N terminal of USP22 corresponding to a region with amino acids RLHSCLYCVFFGCFTKKHIHEHAKAKRHNLAIDLMYGGIYCFLCQDYIYD
- Top Product
- Discover our top product USP22 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
USP22 Blocking Peptide, catalog no. 33R-8029, is also available for use as a blocking control in assays to test for specificity of this USP22 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of USP22 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- USP22 (Ubiquitin Specific Peptidase 22 (USP22))
- Andere Bezeichnung
- USP22 (USP22 Produkte)
- Synonyme
- USP3L antikoerper, AI427806 antikoerper, zgc:136342 antikoerper, usp22 antikoerper, usp22 b antikoerper, usp22-B antikoerper, usp22-a antikoerper, usp3l antikoerper, ubiquitin specific peptidase 22 antikoerper, ubiquitin specific peptidase 22 S homeolog antikoerper, USP22 antikoerper, Usp22 antikoerper, usp22 antikoerper, usp22.S antikoerper
- Hintergrund
- USP22 is a subunit of the SAGA transcriptional cofactor complex. It deubiquitylates histone H2B and is recruited to specific genes by activators like Myc. USP22 is needed for cell cycle progression. It deubiquitylates histone H2A in addition to H2B. Altered mRNA expression is associated with therapy failure and death in patients multiple types of cancer.
- Molekulargewicht
- 60 kDa (MW of target protein)
-