HSPA4 Antikörper (N-Term)
-
- Target Alle HSPA4 Antikörper anzeigen
- HSPA4 (Heat Shock 70kDa Protein 4 (HSPA4))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human, Maus, Hund
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser HSPA4 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- HSPA4 antibody was raised against the N terminal of HSPA4
- Aufreinigung
- Affinity purified
- Immunogen
- HSPA4 antibody was raised using the N terminal of HSPA4 corresponding to a region with amino acids PACISFGPKNRSIGAAAKSQVISNAKNTVQGFKRFHGRAFSDPFVEAEKS
- Top Product
- Discover our top product HSPA4 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
HSPA4 Blocking Peptide, catalog no. 33R-6956, is also available for use as a blocking control in assays to test for specificity of this HSPA4 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HSPA4 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- HSPA4 (Heat Shock 70kDa Protein 4 (HSPA4))
- Andere Bezeichnung
- HSPA4 (HSPA4 Produkte)
- Synonyme
- APG-2 antikoerper, HS24/P52 antikoerper, HSPH2 antikoerper, RY antikoerper, hsp70 antikoerper, hsp70RY antikoerper, Hsp110 antikoerper, Hsp70 antikoerper, irp94 antikoerper, 70kDa antikoerper, AI317151 antikoerper, Hsp70RY antikoerper, mKIAA4025 antikoerper, hspa4 antikoerper, wu:fi30e11 antikoerper, zgc:55743 antikoerper, zgc:77413 antikoerper, hs24/p52 antikoerper, hspa4-a antikoerper, osp94 antikoerper, pg-2 antikoerper, hspa4l antikoerper, wu:fc41d05 antikoerper, wu:fi59h02 antikoerper, wu:fj35c08 antikoerper, zgc:55506 antikoerper, heat shock protein family A (Hsp70) member 4 antikoerper, heat shock protein family A member 4 antikoerper, heat shock protein 4 antikoerper, heat shock protein 4b antikoerper, heat shock protein family A (Hsp70) member 4 S homeolog antikoerper, heat shock protein 4a antikoerper, HSPA4 antikoerper, Hspa4 antikoerper, hspa4b antikoerper, hspa4.S antikoerper, hspa4a antikoerper
- Hintergrund
- HSPA4(Hsp70) belongs to the heat shock protein 70 family. It was isolated as a putative Rictor interacting protein and interaction with membranes acts as a platform for its release into the extracellular environment during its recovery from stress. Hsp70 gene expression in Rheumatoid Arthitis-affected synovial tissue is followed by Hsp70 cell surface expression on fibroblast-like synovial cells growing from RA synovial tissue.
- Molekulargewicht
- 94 kDa (MW of target protein)
-