HSPA4 Antikörper (N-Term)
Kurzübersicht für HSPA4 Antikörper (N-Term) (ABIN631620)
Target
Alle HSPA4 Antikörper anzeigenReaktivität
Wirt
Klonalität
Konjugat
Applikation
-
-
Bindungsspezifität
- N-Term
-
Spezifität
- HSPA4 antibody was raised against the N terminal of HSPA4
-
Aufreinigung
- Affinity purified
-
Immunogen
- HSPA4 antibody was raised using the N terminal of HSPA4 corresponding to a region with amino acids PACISFGPKNRSIGAAAKSQVISNAKNTVQGFKRFHGRAFSDPFVEAEKS
-
-
-
-
Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. -
Kommentare
-
HSPA4 Blocking Peptide, (ABIN5614098), is also available for use as a blocking control in assays to test for specificity of this HSPA4 antibody
-
Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
-
-
Format
- Lyophilized
-
Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HSPA4 antibody in PBS
-
Konzentration
- Lot specific
-
Buffer
- PBS
-
Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. -
Lagerung
- 4 °C/-20 °C
-
Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
-
- HSPA4 (Heat Shock 70kDa Protein 4 (HSPA4))
-
Andere Bezeichnung
- HSPA4
-
Hintergrund
- HSPA4(Hsp70) belongs to the heat shock protein 70 family. It was isolated as a putative Rictor interacting protein and interaction with membranes acts as a platform for its release into the extracellular environment during its recovery from stress. Hsp70 gene expression in Rheumatoid Arthitis-affected synovial tissue is followed by Hsp70 cell surface expression on fibroblast-like synovial cells growing from RA synovial tissue.
-
Molekulargewicht
- 94 kDa (MW of target protein)
Target
-