HSPA4 Antikörper (N-Term)

Produktnummer ABIN631620

Dieses Anti-HSPA4-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von HSPA4 in WB. Geeignet für Human, Maus und Hund.

Kurzübersicht für HSPA4 Antikörper (N-Term) (ABIN631620)

Target: HSPA4 (Heat Shock 70kDa Protein 4 (HSPA4))

Reaktivität: Human, Maus, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser HSPA4 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-HSPA4 Antikörper

Bindungsspezifität: N-Term

Spezifität: HSPA4 antibody was raised against the N terminal of HSPA4

Aufreinigung: Affinity purified

Immunogen: HSPA4 antibody was raised using the N terminal of HSPA4 corresponding to a region with amino acids PACISFGPKNRSIGAAAKSQVISNAKNTVQGFKRFHGRAFSDPFVEAEKS

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

HSPA4 Blocking Peptide, (ABIN5614098), is also available for use as a blocking control in assays to test for specificity of this HSPA4 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HSPA4 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu HSPA4

Target: HSPA4 (Heat Shock 70kDa Protein 4 (HSPA4))

Andere Bezeichnung: HSPA4

Hintergrund: HSPA4(Hsp70) belongs to the heat shock protein 70 family. It was isolated as a putative Rictor interacting protein and interaction with membranes acts as a platform for its release into the extracellular environment during its recovery from stress. Hsp70 gene expression in Rheumatoid Arthitis-affected synovial tissue is followed by Hsp70 cell surface expression on fibroblast-like synovial cells growing from RA synovial tissue.

Molekulargewicht: 94 kDa (MW of target protein)