EEF1A2 Antikörper (Middle Region)

Produktnummer ABIN631619

Produktdetails anti-EEF1A2 Antikörper

Target: EEF1A2 (Eukaryotic Translation Elongation Factor 1 alpha 2 (EEF1A2))

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser EEF1A2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: EEF1 A2 antibody was raised against the middle region of EEF1 2

Aufreinigung: Affinity purified

Immunogen: EEF1 A2 antibody was raised using the middle region of EEF1 2 corresponding to a region with amino acids VIDCHTAHIACKFAELKEKIDRRSGKKLEDNPKSLKSGDAAIVEMVPGKP

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

EEF1A2 Blocking Peptide, catalog no. 33R-9588, is also available for use as a blocking control in assays to test for specificity of this EEF1A2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EEF0 2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu EEF1A2

Target: EEF1A2 (Eukaryotic Translation Elongation Factor 1 alpha 2 (EEF1A2))

Andere Bezeichnung: EEF1A2 (EEF1A2 Produkte)

Synonyme: EEF1AL antikoerper, EF-1-alpha-2 antikoerper, EF1A antikoerper, HS1 antikoerper, STN antikoerper, STNL antikoerper, EEF1A2 antikoerper, Eef1a antikoerper, S1 antikoerper, wasted antikoerper, wst antikoerper, Ps10 antikoerper, RATPS10 antikoerper, Stnl antikoerper, eef1al antikoerper, ef1a antikoerper, stnl antikoerper, EEF1A-2 antikoerper, zgc:92085 antikoerper, eukaryotic translation elongation factor 1 alpha 2 antikoerper, eukaryotic translation elongation factor 1 alpha 1 antikoerper, eukaryotic translation elongation factor 1 alpha 2 S homeolog antikoerper, putative elongation factor 1-alpha-like 3 antikoerper, EEF1A2 antikoerper, EEF1A1 antikoerper, Eef1a2 antikoerper, eef1a2.S antikoerper, eef1a2 antikoerper, LOC739210 antikoerper, EEF1 antikoerper, eef1 antikoerper

Hintergrund: EEF1A2 is an isoform of the alpha subunit of the elongation factor-1 complex, which is responsible for the enzymatic delivery of aminoacyl tRNAs to the ribosome. This isoform (alpha 2) is expressed in brain, heart and skeletal muscle, and the other isoform (alpha 1) is expressed in brain, placenta, lung, liver, kidney, and pancreas. This gene may be critical in the development of ovarian cancer. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.

Molekulargewicht: 50 kDa (MW of target protein)