Keratin 75 Antikörper (Middle Region)
-
- Target Alle Keratin 75 (KRT75) Antikörper anzeigen
- Keratin 75 (KRT75)
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser Keratin 75 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- Cytokeratin 75 antibody was raised against the middle region of KRT75
- Aufreinigung
- Affinity purified
- Immunogen
- Cytokeratin 75 antibody was raised using the middle region of KRT75 corresponding to a region with amino acids SFTTSGGHSLGAGLGGSGFSATSNRGLGGSGSSVKFVSTTSSSQKSYTH
- Top Product
- Discover our top product KRT75 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
Cytokeratin 75 Blocking Peptide, catalog no. 33R-8442, is also available for use as a blocking control in assays to test for specificity of this Cytokeratin 75 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KRT75 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Keratin 75 (KRT75)
- Andere Bezeichnung
- Cytokeratin 75 (KRT75 Produkte)
- Synonyme
- KRT75 antikoerper, K6HF antikoerper, KB18 antikoerper, PFB antikoerper, 4732468K03Rik antikoerper, AA589387 antikoerper, K6hf antikoerper, Krt2-6hf antikoerper, Krtcap1 antikoerper, Kb18 antikoerper, keratin 75 antikoerper, keratin, type II cytoskeletal 75 antikoerper, keratin, type II cytoskeletal 6A antikoerper, KRT75 antikoerper, LOC466991 antikoerper, LOC100566287 antikoerper, Krt75 antikoerper
- Hintergrund
- This gene is a member of the type II keratin family clustered on the long arm of chromosome 12. Type I and type II keratins heteropolymerize to form intermediate-sized filaments in the cytoplasm of epithelial cells.
- Molekulargewicht
- 59 kDa (MW of target protein)
-