Keratin 75 Antikörper (N-Term)

Produktnummer ABIN631611

Produktdetails anti-Keratin 75 Antikörper

Target: Keratin 75 (KRT75)

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Keratin 75 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: Cytokeratin 75 antibody was raised against the N terminal of KRT75

Aufreinigung: Affinity purified

Immunogen: Cytokeratin 75 antibody was raised using the N terminal of KRT75 corresponding to a region with amino acids MSRQSSITFQSGSRRGFSTTSAITPAAGRSRFSSVSVARSAAGSGGLGRI

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Cytokeratin 75 Blocking Peptide, catalog no. 33R-6488, is also available for use as a blocking control in assays to test for specificity of this Cytokeratin 75 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KRT75 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Keratin 75

Target: Keratin 75 (KRT75)

Andere Bezeichnung: Cytokeratin 75 (KRT75 Produkte)

Hintergrund: This gene is a member of the type II keratin family clustered on the long arm of chromosome 12. Type I and type II keratins heteropolymerize to form intermediate-sized filaments in the cytoplasm of epithelial cells.

Molekulargewicht: 59 kDa (MW of target protein)