GAPDHS Antikörper (N-Term)

Produktnummer ABIN631607

Produktdetails anti-GAPDHS Antikörper

Target: GAPDHS (Glyceraldehyde-3-Phosphate Dehydrogenase, Spermatogenic (GAPDHS))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser GAPDHS Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: GAPDHS antibody was raised against the N terminal of GAPDHS

Aufreinigung: Affinity purified

Immunogen: GAPDHS antibody was raised using the N terminal of GAPDHS corresponding to a region with amino acids PFIDPEYMVYMFKYDSTHGRYKGSVEFRNGQLVVDNHEISVYQCKEPKQI

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

GAPDHS Blocking Peptide, catalog no. 33R-7075, is also available for use as a blocking control in assays to test for specificity of this GAPDHS antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GAPDHS antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu GAPDHS

Target: GAPDHS (Glyceraldehyde-3-Phosphate Dehydrogenase, Spermatogenic (GAPDHS))

Andere Bezeichnung: GAPDHS (GAPDHS Produkte)

Synonyme: GAPDS antikoerper, GAPDHS antikoerper, GAPD2 antikoerper, GAPDH-2 antikoerper, HSD-35 antikoerper, Gapd-s antikoerper, Gapds antikoerper, gapdh-2 antikoerper, cb350 antikoerper, fb71f08 antikoerper, fk58c09 antikoerper, g3pdh antikoerper, gapdh antikoerper, gapds antikoerper, wu:fb71f08 antikoerper, wu:fk58c09 antikoerper, zgc:76908 antikoerper, glyceraldehyde-3-phosphate dehydrogenase, spermatogenic antikoerper, GAPDHS antikoerper, Gapdhs antikoerper, gapdhs antikoerper

Hintergrund: GAPDHS is a protein belonging to the glyceraldehyde-3-phosphate dehydrogenase family of enzymes that play an important role in carbohydrate metabolism.

Molekulargewicht: 44 kDa (MW of target protein)

Pathways: Regulation of Carbohydrate Metabolic Process