GAPDHS Antikörper (N-Term)

Produktnummer ABIN631607

Der Kaninchen Polyklonal Anti-GAPDHS-Antikörper wurde für WB validiert. Er ist geeignet, GAPDHS in Proben von Human zu detektieren.

Kurzübersicht für GAPDHS Antikörper (N-Term) (ABIN631607)

Target: GAPDHS (Glyceraldehyde-3-Phosphate Dehydrogenase, Spermatogenic (GAPDHS))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser GAPDHS Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-GAPDHS Antikörper

Bindungsspezifität: N-Term

Spezifität: GAPDHS antibody was raised against the N terminal of GAPDHS

Aufreinigung: Affinity purified

Immunogen: GAPDHS antibody was raised using the N terminal of GAPDHS corresponding to a region with amino acids PFIDPEYMVYMFKYDSTHGRYKGSVEFRNGQLVVDNHEISVYQCKEPKQI

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

GAPDHS Blocking Peptide, (ABIN5613726), is also available for use as a blocking control in assays to test for specificity of this GAPDHS antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GAPDHS antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu GAPDHS

Target: GAPDHS (Glyceraldehyde-3-Phosphate Dehydrogenase, Spermatogenic (GAPDHS))

Andere Bezeichnung: GAPDHS

Hintergrund: GAPDHS is a protein belonging to the glyceraldehyde-3-phosphate dehydrogenase family of enzymes that play an important role in carbohydrate metabolism.

Molekulargewicht: 44 kDa (MW of target protein)

Pathways: Regulation of Carbohydrate Metabolic Process