DHDDS Antikörper (N-Term)

Produktnummer ABIN631604

Der Kaninchen Polyklonal Anti-DHDDS-Antikörper wurde für WB validiert. Er ist geeignet, DHDDS in Proben von Human zu detektieren.

Kurzübersicht für DHDDS Antikörper (N-Term) (ABIN631604)

Target: DHDDS (Dehydrodolichyl Diphosphate Synthase (DHDDS))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser DHDDS Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-DHDDS Antikörper

Bindungsspezifität: N-Term

Spezifität: DHDDS antibody was raised against the N terminal of DHDDS

Aufreinigung: Affinity purified

Immunogen: DHDDS antibody was raised using the N terminal of DHDDS corresponding to a region with amino acids NRRYAKKCQVERQEGHSQGFNKLAETLRWCLNLGILEVTVYAFSIENFKR

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

DHDDS Blocking Peptide, (ABIN5613188), is also available for use as a blocking control in assays to test for specificity of this DHDDS antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DHDDS antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu DHDDS

Target: DHDDS (Dehydrodolichyl Diphosphate Synthase (DHDDS))

Andere Bezeichnung: DHDDS

Hintergrund: Dehydrodolichyl diphosphate (dedol-PP) synthase catalyzes cis-prenyl chain elongation to produce the polyprenyl backbone of dolichol, a glycosyl carrier lipid required for the biosynthesis of several classes of glycoproteins.

Molekulargewicht: 39 kDa (MW of target protein)