Vimentin Antikörper (N-Term)
-
- Target Alle Vimentin (VIM) Antikörper anzeigen
- Vimentin (VIM)
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser Vimentin Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- Vimentin antibody was raised against the N terminal of VIM
- Aufreinigung
- Affinity purified
- Immunogen
- Vimentin antibody was raised using the N terminal of VIM corresponding to a region with amino acids LNDRFANYIDKVRFLEQQNKILLAELEQLKGQGKSRLGDLYEEEMRELRR
- Top Product
- Discover our top product VIM Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
Vimentin Blocking Peptide, catalog no. 33R-5218, is also available for use as a blocking control in assays to test for specificity of this Vimentin antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of VIM antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Vimentin (VIM)
- Andere Bezeichnung
- Vimentin (VIM Produkte)
- Synonyme
- CTRCT30 antikoerper, cb28 antikoerper, vime antikoerper, vim antikoerper, vim1 antikoerper, vim2 antikoerper, VIM antikoerper, Vimentin antikoerper, vim4 antikoerper, vimentin antikoerper, vimentin L homeolog antikoerper, vimentin S homeolog antikoerper, VIM antikoerper, Vim antikoerper, vim antikoerper, vim.L antikoerper, vim.S antikoerper
- Hintergrund
- Along with the microfilaments (actins) and microtubules (tubulins), the intermediate filaments represent a third class of well-characterized cytoskeletal elements. The subunits display a tissue-specific pattern of expression. Desmin is the subunit specific for muscle and vimentin the subunit specific for mesenchymal tissue.
- Molekulargewicht
- 54 kDa (MW of target protein)
- Pathways
- Caspase Kaskade in der Apoptose
-