RPL13A Antikörper (Middle Region)

Produktnummer ABIN631597

Produktdetails anti-RPL13A Antikörper

Target: RPL13A (Ribosomal Protein L13a (RPL13A))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser RPL13A Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: RPL13 A antibody was raised against the middle region of RPL13

Aufreinigung: Affinity purified

Immunogen: RPL13 A antibody was raised using the middle region of RPL13 corresponding to a region with amino acids HEVGWKYQAVTATLEEKRKEKAKIHYRKKKQLMRLRKQAEKNVEKKIDKY

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

RPL13A Blocking Peptide, catalog no. 33R-3724, is also available for use as a blocking control in assays to test for specificity of this RPL13A antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RPL10 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu RPL13A

Target: RPL13A (Ribosomal Protein L13a (RPL13A))

Andere Bezeichnung: RPL13A (RPL13A Produkte)

Synonyme: 1810026N22Rik antikoerper, Tstap198-7 antikoerper, tum-antigen antikoerper, L13A antikoerper, TSTA1 antikoerper, CG1475 antikoerper, Dmel\\CG1475 antikoerper, L13a2 antikoerper, M(3)83B antikoerper, Rp L13A antikoerper, anon-EST:Posey125 antikoerper, anon-EST:fe1A5 antikoerper, bs25f04.y1 antikoerper, cg1475 antikoerper, MGC54018 antikoerper, GB16111 antikoerper, hm:zehp0384 antikoerper, wu:fa95e06 antikoerper, wu:fb08g07 antikoerper, wu:fd05d08 antikoerper, DDBDRAFT_0217704 antikoerper, DDBDRAFT_0231192 antikoerper, DDB_0217704 antikoerper, DDB_0231192 antikoerper, ribosomal protein L13A antikoerper, ribosomal protein L13a antikoerper, Ribosomal protein L13A antikoerper, ribosomal protein L13a S homeolog antikoerper, 60S ribosomal protein L13a antikoerper, ribosomal protein 13a antikoerper, ribosomal 60S subunit protein L13A antikoerper, Ribosomal protein L13a, component of cytosolic 80S ribosome and 60S large subunit antikoerper, S60 ribosomal protein L13a antikoerper, Rpl13a antikoerper, RPL13A antikoerper, RpL13A antikoerper, rpl13a.S antikoerper, rpl13a antikoerper, LOC551418 antikoerper, LOC663151 antikoerper, RPL13a antikoerper

Hintergrund: Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins.

Molekulargewicht: 22 kDa (MW of target protein)