RPL13A Antikörper (Middle Region)

Produktnummer ABIN631597

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch RPL13A in WB. Er zeigt eine Reaktivität gegenüber Human.

Kurzübersicht für RPL13A Antikörper (Middle Region) (ABIN631597)

Target: RPL13A (Ribosomal Protein L13a (RPL13A))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser RPL13A Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-RPL13A Antikörper

Bindungsspezifität: Middle Region

Spezifität: RPL13 A antibody was raised against the middle region of RPL13

Aufreinigung: Affinity purified

Immunogen: RPL13 A antibody was raised using the middle region of RPL13 corresponding to a region with amino acids HEVGWKYQAVTATLEEKRKEKAKIHYRKKKQLMRLRKQAEKNVEKKIDKY

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

RPL13A Blocking Peptide, (ABIN939110), is also available for use as a blocking control in assays to test for specificity of this RPL13A antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RPL10 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu RPL13A

Target: RPL13A (Ribosomal Protein L13a (RPL13A))

Andere Bezeichnung: RPL13A

Hintergrund: Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins.

Molekulargewicht: 22 kDa (MW of target protein)