RPL13A Antikörper (Middle Region)

Produktnummer ABIN631597

Produktdetails anti-RPL13A Antikörper

Target: RPL13A (Ribosomal Protein L13a (RPL13A))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser RPL13A Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: RPL13 A antibody was raised against the middle region of RPL13

Aufreinigung: Affinity purified

Immunogen: RPL13 A antibody was raised using the middle region of RPL13 corresponding to a region with amino acids HEVGWKYQAVTATLEEKRKEKAKIHYRKKKQLMRLRKQAEKNVEKKIDKY

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

RPL13A Blocking Peptide, catalog no. 33R-3724, is also available for use as a blocking control in assays to test for specificity of this RPL13A antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RPL10 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu RPL13A

Target: RPL13A (Ribosomal Protein L13a (RPL13A))

Andere Bezeichnung: RPL13A (RPL13A Produkte)

Hintergrund: Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins.

Molekulargewicht: 22 kDa (MW of target protein)