KPTN Antikörper

Produktnummer ABIN631596

Produktdetails anti-KPTN Antikörper

Target: KPTN (Kaptin (Actin Binding Protein) (KPTN))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser KPTN Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: Kaptin antibody was raised using a synthetic peptide corresponding to a region with amino acids MGEAAVAAGPCPLREDSFTRFSSQSNVYGLAGGAGGRGELLAATLKGKVL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Kaptin Blocking Peptide, catalog no. 33R-6017, is also available for use as a blocking control in assays to test for specificity of this Kaptin antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KPTN antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu KPTN

Target: KPTN (Kaptin (Actin Binding Protein) (KPTN))

Andere Bezeichnung: Kaptin (KPTN Produkte)

Synonyme: 2310042D10Rik antikoerper, 2E4 antikoerper, C030013F01Rik antikoerper, wu:fc13b08 antikoerper, wu:fc13b09 antikoerper, zgc:100793 antikoerper, kaptin, actin binding protein antikoerper, kaptin antikoerper, kaptin (actin binding protein) antikoerper, kaptin (actin binding protein) L homeolog antikoerper, kptn antikoerper, Kptn antikoerper, KPTN antikoerper, kptn.L antikoerper

Hintergrund: KPTN may be involved in actin dynamics. KPTN may play a role in producing the sensory apparatus in hair cells. KPTN may also play a role in actin rearrangements that accompany platelet activation and stereocilia formation.

Molekulargewicht: 47 kDa (MW of target protein)

Pathways: Sensory Perception of Sound