KPTN Antikörper
-
- Target Alle KPTN Antikörper anzeigen
- KPTN (Kaptin (Actin Binding Protein) (KPTN))
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser KPTN Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- Kaptin antibody was raised using a synthetic peptide corresponding to a region with amino acids MGEAAVAAGPCPLREDSFTRFSSQSNVYGLAGGAGGRGELLAATLKGKVL
- Top Product
- Discover our top product KPTN Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
Kaptin Blocking Peptide, catalog no. 33R-6017, is also available for use as a blocking control in assays to test for specificity of this Kaptin antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KPTN antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- KPTN (Kaptin (Actin Binding Protein) (KPTN))
- Andere Bezeichnung
- Kaptin (KPTN Produkte)
- Hintergrund
- KPTN may be involved in actin dynamics. KPTN may play a role in producing the sensory apparatus in hair cells. KPTN may also play a role in actin rearrangements that accompany platelet activation and stereocilia formation.
- Molekulargewicht
- 47 kDa (MW of target protein)
- Pathways
- Sensory Perception of Sound
-