Catalase Antikörper (Middle Region)

Produktnummer ABIN631595

This anti-Catalase antibody (ABIN631595) is a Rabbit Polyclonal antibody detecting Catalase in WB. Suitable for Human, Mouse, Dog.

Kurzübersicht für Catalase Antikörper (Middle Region) (ABIN631595)

Target: Catalase (CAT)

Reaktivität: Human, Maus, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Catalase Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-Catalase Antikörper

Bindungsspezifität: Middle Region

Spezifität: Catalase antibody was raised against the middle region of CAT

Aufreinigung: Affinity purified

Immunogen: Catalase antibody was raised using the middle region of CAT corresponding to a region with amino acids LKDAQIFIQKKAVKNFTEVHPDYGSHIQALLDKYNAEKPKNAIHTFVQSG

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Catalase Blocking Peptide, catalog no. 33R-5077, is also available for use as a blocking control in assays to test for specificity of this Catalase antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CAT antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Referenzen für anti-Catalase Antikörper (ABIN631595)

Makkar, Contreras, Paintlia, Smith, Haq, Singh: "Molecular organization of peroxisomal enzymes: protein-protein interactions in the membrane and in the matrix." in: Archives of biochemistry and biophysics, Vol. 451, Issue 2, pp. 128-40, (2006) (PubMed).

Details zu Catalase

Target: Catalase (CAT)

Andere Bezeichnung: Catalase

Hintergrund: This gene encodes catalase, a key antioxidant enzyme in the bodies defense against oxidative stress. Catalase is a heme enzyme that is present in the peroxisome of nearly all aerobic cells.

Molekulargewicht: 58 kDa (MW of target protein)

Pathways: Cellular Glucan Metabolic Process, Cell RedoxHomeostasis, Photoperiodism