ARHGAP25 Antikörper (Middle Region)

Produktnummer ABIN631594

Produktdetails anti-ARHGAP25 Antikörper

Target: ARHGAP25 (rho GTPase Activating Protein 25 (ARHGAP25))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ARHGAP25 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: ARHGAP25 antibody was raised against the middle region of ARHGAP25

Aufreinigung: Affinity purified

Immunogen: ARHGAP25 antibody was raised using the middle region of ARHGAP25 corresponding to a region with amino acids SPGEEASALSSQACDSKGDTLASPNSETGPGKKNSGEEEIDSLQRMVQEL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ARHGAP25 Blocking Peptide, catalog no. 33R-8674, is also available for use as a blocking control in assays to test for specificity of this ARHGAP25 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ARHGAP25 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ARHGAP25

Target: ARHGAP25 (rho GTPase Activating Protein 25 (ARHGAP25))

Andere Bezeichnung: ARHGAP25 (ARHGAP25 Produkte)

Synonyme: arhgap24 antikoerper, DKFZp468H165 antikoerper, KAIA0053 antikoerper, A130039I20Rik antikoerper, RGD1562105 antikoerper, Rho GTPase activating protein 25 antikoerper, ARHGAP25 antikoerper, arhgap25 antikoerper, Arhgap25 antikoerper

Hintergrund: ARHGAPs, such as ARHGAP25, encode negative regulators of Rho GTPases, which are implicated in actin remodeling, cell polarity, and cell migration.

Molekulargewicht: 70 kDa (MW of target protein)