ARHGAP25 Antikörper (Middle Region)
-
- Target Alle ARHGAP25 Antikörper anzeigen
- ARHGAP25 (rho GTPase Activating Protein 25 (ARHGAP25))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser ARHGAP25 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- ARHGAP25 antibody was raised against the middle region of ARHGAP25
- Aufreinigung
- Affinity purified
- Immunogen
- ARHGAP25 antibody was raised using the middle region of ARHGAP25 corresponding to a region with amino acids SPGEEASALSSQACDSKGDTLASPNSETGPGKKNSGEEEIDSLQRMVQEL
- Top Product
- Discover our top product ARHGAP25 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
ARHGAP25 Blocking Peptide, catalog no. 33R-8674, is also available for use as a blocking control in assays to test for specificity of this ARHGAP25 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ARHGAP25 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ARHGAP25 (rho GTPase Activating Protein 25 (ARHGAP25))
- Andere Bezeichnung
- ARHGAP25 (ARHGAP25 Produkte)
- Synonyme
- arhgap24 antikoerper, DKFZp468H165 antikoerper, KAIA0053 antikoerper, A130039I20Rik antikoerper, RGD1562105 antikoerper, Rho GTPase activating protein 25 antikoerper, ARHGAP25 antikoerper, arhgap25 antikoerper, Arhgap25 antikoerper
- Hintergrund
- ARHGAPs, such as ARHGAP25, encode negative regulators of Rho GTPases, which are implicated in actin remodeling, cell polarity, and cell migration.
- Molekulargewicht
- 70 kDa (MW of target protein)
-