SCYL3 Antikörper

Produktnummer ABIN631591

Dieser Kaninchen Polyklonal Antikörper erkennt spezifisch SCYL3 in WB. Er zeigt eine Reaktivität gegenüber Human und Maus.

Kurzübersicht für SCYL3 Antikörper (ABIN631591)

Target: SCYL3 (SCY1-Like 3 (SCYL3))

Reaktivität: Human, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SCYL3 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-SCYL3 Antikörper

Aufreinigung: Affinity purified

Immunogen: SCYL3 antibody was raised using a synthetic peptide corresponding to a region with amino acids MGSENSALKSYTLREPPFTLPSGLAVYPAVLQDGKFASVFVYKRENEDKV

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SCYL3 Blocking Peptide, (ABIN5616018), is also available for use as a blocking control in assays to test for specificity of this SCYL3 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SCYL3 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SCYL3

Target: SCYL3 (SCY1-Like 3 (SCYL3))

Andere Bezeichnung: SCYL3

Hintergrund: SCYL3 may play a role in regulating cell adhesion/migration complexes in migrating cells.

Molekulargewicht: 83 kDa (MW of target protein)