Telefon:
+49 (0)241 95 163 153
Fax:
+49 (0)241 95 163 155
E-Mail:
orders@antikoerper-online.de

SCYL3 Antikörper

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch SCYL3 in WB. Er zeigt eine Reaktivität gegenüber Human und Maus.
Produktnummer ABIN631591

Kurzübersicht für SCYL3 Antikörper (ABIN631591)

Target

Alle SCYL3 Antikörper anzeigen
SCYL3 (SCY1-Like 3 (SCYL3))

Reaktivität

  • 23
  • 13
  • 3
  • 2
  • 2
  • 2
  • 2
  • 1
  • 1
  • 1
Human, Maus

Wirt

  • 24
  • 8
Kaninchen

Klonalität

  • 26
  • 6
Polyklonal

Konjugat

  • 23
  • 3
  • 2
  • 2
  • 1
  • 1
Dieser SCYL3 Antikörper ist unkonjugiert

Applikation

  • 26
  • 14
  • 14
  • 6
  • 5
  • 2
  • 2
  • 1
  • 1
  • 1
Western Blotting (WB)
  • Aufreinigung

    Affinity purified

    Immunogen

    SCYL3 antibody was raised using a synthetic peptide corresponding to a region with amino acids MGSENSALKSYTLREPPFTLPSGLAVYPAVLQDGKFASVFVYKRENEDKV
  • Applikationshinweise

    WB: 1 µg/mL
    Optimal conditions should be determined by the investigator.

    Kommentare

    SCYL3 Blocking Peptide, (ABIN5616018), is also available for use as a blocking control in assays to test for specificity of this SCYL3 antibody

    Beschränkungen

    Nur für Forschungszwecke einsetzbar
  • Format

    Lyophilized

    Rekonstitution

    Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SCYL3 antibody in PBS

    Konzentration

    Lot specific

    Buffer

    PBS

    Handhabung

    Avoid repeated freeze/thaw cycles.

    Lagerung

    4 °C/-20 °C

    Informationen zur Lagerung

    Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
  • Target

    SCYL3 (SCY1-Like 3 (SCYL3))

    Andere Bezeichnung

    SCYL3

    Hintergrund

    SCYL3 may play a role in regulating cell adhesion/migration complexes in migrating cells.

    Molekulargewicht

    83 kDa (MW of target protein)
Sie sind hier:
Chat with us!