CENPQ Antikörper (N-Term)

Produktnummer ABIN631590

Produktdetails anti-CENPQ Antikörper

Target: CENPQ (Centromere Protein Q (CENPQ))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CENPQ Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: CENPQ antibody was raised against the N terminal of CENPQ

Aufreinigung: Affinity purified

Immunogen: CENPQ antibody was raised using the N terminal of CENPQ corresponding to a region with amino acids VRNTVKKNKNHLKDLSSEGQTKHTNLKHGKTAASKRKTWQPLSKSTRDHL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

CENPQ Blocking Peptide, catalog no. 33R-9780, is also available for use as a blocking control in assays to test for specificity of this CENPQ antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CENPQ antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu CENPQ

Target: CENPQ (Centromere Protein Q (CENPQ))

Andere Bezeichnung: CENPQ (CENPQ Produkte)

Synonyme: C6orf139 antikoerper, CENP-Q antikoerper, 2610528M18Rik antikoerper, centromere protein Q antikoerper, CENPQ antikoerper, cenpq antikoerper, Cenpq antikoerper

Hintergrund: CENPQ is a subunit of a CENPH-CENPI-associated centromeric complex that targets CENPA to centromeres and is required for proper kinetochore function and mitotic progression.

Molekulargewicht: 30 kDa (MW of target protein)