FAIM Antikörper (Middle Region)

Produktnummer ABIN631584

Der Kaninchen Polyklonal anti-FAIM Antikörper (ABIN631584) detektiert spezifisch FAIM in WB. Dieser Antikörper reagiert spezifisch mit Proben aus Human, Maus und Ratte.

Kurzübersicht für FAIM Antikörper (Middle Region) (ABIN631584)

Target: FAIM (Fas Apoptotic Inhibitory Molecule (FAIM))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser FAIM Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-FAIM Antikörper

Bindungsspezifität: Middle Region

Spezifität: FAIM antibody was raised against the middle region of FAIM

Aufreinigung: Affinity purified

Immunogen: FAIM antibody was raised using the middle region of FAIM corresponding to a region with amino acids FRIVLEKDAMDVWCNGKKLETAGEFVDDGTETHFSIGNHDCYIKAVSSGK

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

FAIM Blocking Peptide, (ABIN938436), is also available for use as a blocking control in assays to test for specificity of this FAIM antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FAIM antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu FAIM

Target: FAIM (Fas Apoptotic Inhibitory Molecule (FAIM))

Andere Bezeichnung: FAIM

Hintergrund: FAIM plays a role as an inducible effector molecule that mediates Fas resistance produced by surface Ig engagement in B cells.

Molekulargewicht: 24 kDa (MW of target protein)