FAIM Antikörper (N-Term)

Produktnummer ABIN631583

Der Kaninchen Polyklonal Anti-FAIM-Antikörper wurde für WB validiert. Er ist geeignet, FAIM in Proben von Human, Maus und Ratte zu detektieren.

Kurzübersicht für FAIM Antikörper (N-Term) (ABIN631583)

Target: FAIM (Fas Apoptotic Inhibitory Molecule (FAIM))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser FAIM Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-FAIM Antikörper

Bindungsspezifität: N-Term

Spezifität: FAIM antibody was raised against the N terminal of FAIM

Aufreinigung: Affinity purified

Immunogen: FAIM antibody was raised using the N terminal of FAIM corresponding to a region with amino acids MTDLVAVWDVALSDGVHKIEFEHGTTSGKRVVYVDGKEEIRKEWMFKLVG

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

FAIM Blocking Peptide, (ABIN5613457), is also available for use as a blocking control in assays to test for specificity of this FAIM antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FAIM antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu FAIM

Target: FAIM (Fas Apoptotic Inhibitory Molecule (FAIM))

Andere Bezeichnung: FAIM

Hintergrund: FAIM plays a role as an inducible effector molecule that mediates Fas resistance produced by surface Ig engagement in B cells.

Molekulargewicht: 24 kDa (MW of target protein)