RPS15A Antikörper (Middle Region)

Produktnummer ABIN631582

Produktdetails anti-RPS15A Antikörper

Target: RPS15A (RA) (Ribosomal Protein S15a (RA))

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser RPS15A Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: RPS15 A antibody was raised against the middle region of RPS15

Aufreinigung: Affinity purified

Immunogen: RPS15 A antibody was raised using the middle region of RPS15 corresponding to a region with amino acids KCGVISPRFDVQLKDLEKWQNNLLPSRQFGFIVLTTSAGIMDHEEARRKH

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

RPS15A Blocking Peptide, catalog no. 33R-4269, is also available for use as a blocking control in assays to test for specificity of this RPS15A antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RPS10 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu RPS15A

Target: RPS15A (RA) (Ribosomal Protein S15a (RA))

Andere Bezeichnung: RPS15A (RA Produkte)

Synonyme: S15a antikoerper, A630031B11Rik antikoerper, wu:fb04b07 antikoerper, ribosomal protein S15a antikoerper, ribosomal protein S15A antikoerper, ribosomal protein S15a S homeolog antikoerper, 40S ribosomal protein S15a antikoerper, Rps15a antikoerper, RPS15A antikoerper, rps15a antikoerper, rps15a.S antikoerper, LOC619131 antikoerper

Hintergrund: Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a ribosomal protein that is a component of the 40S subunit.

Molekulargewicht: 15 kDa (MW of target protein)