RPS15A Antikörper (Middle Region)

Produktnummer ABIN631582

Dieser Kaninchen Polyklonal Antikörper detektiert spezifisch RPS15A in WB. Es zeigt Reaktivität gegenüber Proben von Human, Maus und Ratte.

Kurzübersicht für RPS15A Antikörper (Middle Region) (ABIN631582)

Target: RPS15A (RA) (Ribosomal Protein S15a (RA))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser RPS15A Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-RPS15A Antikörper

Bindungsspezifität: Middle Region

Spezifität: RPS15 A antibody was raised against the middle region of RPS15

Aufreinigung: Affinity purified

Immunogen: RPS15 A antibody was raised using the middle region of RPS15 corresponding to a region with amino acids KCGVISPRFDVQLKDLEKWQNNLLPSRQFGFIVLTTSAGIMDHEEARRKH

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

RPS15A Blocking Peptide, (ABIN939655), is also available for use as a blocking control in assays to test for specificity of this RPS15A antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RPS10 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu RPS15A

Target: RPS15A (RA) (Ribosomal Protein S15a (RA))

Andere Bezeichnung: RPS15A

Hintergrund: Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a ribosomal protein that is a component of the 40S subunit.

Molekulargewicht: 15 kDa (MW of target protein)