GOPC Antikörper (N-Term)

Produktnummer ABIN631580

Der Kaninchen Polyklonal Anti-GOPC-Antikörper wurde für WB validiert. Er ist geeignet, GOPC in Proben von Human und Maus zu detektieren.

Kurzübersicht für GOPC Antikörper (N-Term) (ABIN631580)

Target: GOPC (Golgi-Associated PDZ and Coiled-Coil Motif Containing (GOPC))

Reaktivität: Human, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser GOPC Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-GOPC Antikörper

Bindungsspezifität: N-Term

Spezifität: GOPC antibody was raised against the N terminal of GOPC

Aufreinigung: Affinity purified

Immunogen: GOPC antibody was raised using the N terminal of GOPC corresponding to a region with amino acids EVLEKEFDKAFVDVDLLLGEIDPDQADITYEGRQKMTSLSSCFAQLCHKA

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

GOPC Blocking Peptide, (ABIN938185), is also available for use as a blocking control in assays to test for specificity of this GOPC antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GOPC antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu GOPC

Target: GOPC (Golgi-Associated PDZ and Coiled-Coil Motif Containing (GOPC))

Andere Bezeichnung: GOPC

Hintergrund: GOPC plays a role in intracellular protein trafficking and degradation. GOPC may regulate CFTR chloride currents and acid-induced ACCN3 currents by modulating cell surface expression of both channels. GOPC may also regulate the intracellular trafficking of the ADR1B receptor. GOPC may play a role in autophagy.

Molekulargewicht: 50 kDa (MW of target protein)

Pathways: Maintenance of Protein Location, Asymmetric Protein Localization