RPS15 Antikörper (Middle Region)

Produktnummer ABIN631579

Dieser Kaninchen Polyklonal Antikörper erkennt spezifisch RPS15 in WB. Er zeigt eine Reaktivität gegenüber Human, Maus, Ratte und C. elegans.

Kurzübersicht für RPS15 Antikörper (Middle Region) (ABIN631579)

Target: RPS15 (Ribosomal Protein S15 (RPS15))

Reaktivität: Human, Maus, Ratte, C. elegans

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser RPS15 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-RPS15 Antikörper

Bindungsspezifität: Middle Region

Spezifität: RPS15 antibody was raised against the middle region of RPS15

Aufreinigung: Affinity purified

Immunogen: RPS15 antibody was raised using the middle region of RPS15 corresponding to a region with amino acids GVYNGKTFNQVEIKPEMIGHYLGEFSITYKPVKHGRPGIGATHSSRFIPL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

RPS15 Blocking Peptide, (ABIN939048), is also available for use as a blocking control in assays to test for specificity of this RPS15 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RPS15 antibody in PBS

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu RPS15

Target: RPS15 (Ribosomal Protein S15 (RPS15))

Andere Bezeichnung: RPS15

Hintergrund: Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins.

Molekulargewicht: 17 kDa (MW of target protein)

Pathways: Ribonucleoprotein Complex Subunit Organization, Ribosome Assembly