RPS15 Antikörper (Middle Region)

Produktnummer ABIN631579

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch RPS15 in WB. Er zeigt eine Reaktivität gegenüber Human, Maus, Ratte und C. elegans.

Kurzübersicht für RPS15 Antikörper (Middle Region) (ABIN631579)

Target: RPS15 (Ribosomal Protein S15 (RPS15))

Reaktivität: Human, Maus, Ratte, C. elegans

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser RPS15 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-RPS15 Antikörper

Bindungsspezifität: Middle Region

Spezifität: RPS15 antibody was raised against the middle region of RPS15

Aufreinigung: Affinity purified

Immunogen: RPS15 antibody was raised using the middle region of RPS15 corresponding to a region with amino acids GVYNGKTFNQVEIKPEMIGHYLGEFSITYKPVKHGRPGIGATHSSRFIPL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

RPS15 Blocking Peptide, catalog no. 33R-3662, is also available for use as a blocking control in assays to test for specificity of this RPS15 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RPS15 antibody in PBS

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu RPS15

Target: RPS15 (Ribosomal Protein S15 (RPS15))

Andere Bezeichnung: RPS15

Hintergrund: Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins.

Molekulargewicht: 17 kDa (MW of target protein)

Pathways: Ribonucleoprotein Complex Subunit Organization, Ribosome Assembly