RPL37A Antikörper (Middle Region)

Produktnummer ABIN631577

Der Kaninchen Polyklonal Anti-RPL37A-Antikörper wurde für WB validiert. Er ist geeignet, RPL37A in Proben von Human, Maus und Ratte zu detektieren.

Kurzübersicht für RPL37A Antikörper (Middle Region) (ABIN631577)

Target: RPL37A (Ribosomal Protein L37a (RPL37A))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser RPL37A Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-RPL37A Antikörper

Bindungsspezifität: Middle Region

Spezifität: RPL37 A antibody was raised against the middle region of RPL37

Aufreinigung: Affinity purified

Immunogen: RPL37 A antibody was raised using the middle region of RPL37 corresponding to a region with amino acids CGKTKMKRRAVGIWHCGSCMKTVAGGAWTYNTTSAVTVKSAIRRLKELKD

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

RPL37A Blocking Peptide, (ABIN937089), is also available for use as a blocking control in assays to test for specificity of this RPL37A antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RPL30 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu RPL37A

Target: RPL37A (Ribosomal Protein L37a (RPL37A))

Andere Bezeichnung: RPL37A

Hintergrund: Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins.

Molekulargewicht: 10 kDa (MW of target protein)