Keratin 84 Antikörper (Middle Region)

Produktnummer ABIN631575

Produktdetails anti-Keratin 84 Antikörper

Target: Keratin 84 (KRT84)

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Keratin 84 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: Cytokeratin 84 antibody was raised against the middle region of KRT84

Aufreinigung: Affinity purified

Immunogen: Cytokeratin 84 antibody was raised using the middle region of KRT84 corresponding to a region with amino acids ESYITNLRRQLEVLVSDQARLQAERNHLQDVLEGFKKKYEEEVVCRANAE

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Cytokeratin 84 Blocking Peptide, catalog no. 33R-2754, is also available for use as a blocking control in assays to test for specificity of this Cytokeratin 84 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KRT84 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Keratin 84

Target: Keratin 84 (KRT84)

Abstract: KRT84 Produkte

Synonyme: Kb24 antikoerper, KRT84 antikoerper, KRTHB4 antikoerper, HB4 antikoerper, AV235125 antikoerper, HRb-1 antikoerper, Krt2-16 antikoerper, Krt2-3 antikoerper, keratin 84 antikoerper, Krt84 antikoerper, KRT84 antikoerper

Hintergrund: The protein encoded by this gene is a member of the keratin gene family. As a type II hair keratin, it is a basic protein which heterodimerizes with type I keratins to form hair and nails.

Molekulargewicht: 65 kDa (MW of target protein)