PDLIM3 Antikörper (N-Term)

Produktnummer ABIN631568

Produktdetails anti-PDLIM3 Antikörper

Target: PDLIM3 (PDZ and LIM Domain 3 (PDLIM3))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PDLIM3 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: PDLIM3 antibody was raised against the N terminal of PDLIM3

Aufreinigung: Affinity purified

Immunogen: PDLIM3 antibody was raised using the N terminal of PDLIM3 corresponding to a region with amino acids PQTVILPGPAPWGFRLSGGIDFNQPLVITRITPGSKAAAANLCPGDVILA

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PDLIM3 Blocking Peptide, catalog no. 33R-7314, is also available for use as a blocking control in assays to test for specificity of this PDLIM3 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PDLIM3 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PDLIM3

Target: PDLIM3 (PDZ and LIM Domain 3 (PDLIM3))

Andere Bezeichnung: PDLIM3 (PDLIM3 Produkte)

Synonyme: LIM antikoerper, Actn2lp antikoerper, Alp antikoerper, AI463105 antikoerper, ALP antikoerper, alp antikoerper, hm:zeh1190 antikoerper, pdlim3 antikoerper, sb:eu571 antikoerper, zgc:110415 antikoerper, PDZ and LIM domain 3 antikoerper, PDZ and LIM domain 3 S homeolog antikoerper, PDZ and LIM domain 3b antikoerper, PDZ and LIM domain 3a antikoerper, PDLIM3 antikoerper, Pdlim3 antikoerper, pdlim3.S antikoerper, pdlim3b antikoerper, pdlim3a antikoerper

Hintergrund: PDLIM3 contains a PDZ domain and a LIM domain, indicating that it may be involved in cytoskeletal assembly. In support of this, PDLIM3 has been shown to bind the spectrin-like repeats of alpha-actinin-2 and to colocalize with alpha-actinin-2 at the Z lines of skeletal muscle.

Molekulargewicht: 39 kDa (MW of target protein)