PDLIM3 Antikörper (N-Term)

Produktnummer ABIN631568

Der Kaninchen Polyklonal Anti-PDLIM3-Antikörper wurde für WB validiert. Er ist geeignet, PDLIM3 in Proben von Human, Maus und Ratte zu detektieren.

Kurzübersicht für PDLIM3 Antikörper (N-Term) (ABIN631568)

Target: PDLIM3 (PDZ and LIM Domain 3 (PDLIM3))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PDLIM3 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-PDLIM3 Antikörper

Bindungsspezifität: N-Term

Spezifität: PDLIM3 antibody was raised against the N terminal of PDLIM3

Aufreinigung: Affinity purified

Immunogen: PDLIM3 antibody was raised using the N terminal of PDLIM3 corresponding to a region with amino acids PQTVILPGPAPWGFRLSGGIDFNQPLVITRITPGSKAAAANLCPGDVILA

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PDLIM3 Blocking Peptide, (ABIN5615292), is also available for use as a blocking control in assays to test for specificity of this PDLIM3 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PDLIM3 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PDLIM3

Target: PDLIM3 (PDZ and LIM Domain 3 (PDLIM3))

Andere Bezeichnung: PDLIM3

Hintergrund: PDLIM3 contains a PDZ domain and a LIM domain, indicating that it may be involved in cytoskeletal assembly. In support of this, PDLIM3 has been shown to bind the spectrin-like repeats of alpha-actinin-2 and to colocalize with alpha-actinin-2 at the Z lines of skeletal muscle.

Molekulargewicht: 39 kDa (MW of target protein)