GLO1 Antikörper (N-Term)

Produktnummer ABIN631567

Produktdetails anti-GLO1 Antikörper

Target: GLO1 (Glyoxalase I (GLO1))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser GLO1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: GLO1 antibody was raised against the N terminal of GLO1

Aufreinigung: Affinity purified

Immunogen: GLO1 antibody was raised using the N terminal of GLO1 corresponding to a region with amino acids TMLRVKDPKKSLDFYTRVLGMTLIQKCDFPIMKFSLYFLAYEDKNDIPKE

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

GLO1 Blocking Peptide, catalog no. 33R-9204, is also available for use as a blocking control in assays to test for specificity of this GLO1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GLO1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu GLO1

Target: GLO1 (Glyoxalase I (GLO1))

Andere Bezeichnung: GLO1 (GLO1 Produkte)

Synonyme: GLOD1 antikoerper, GLYI antikoerper, 0610009E22Rik antikoerper, 1110008E19Rik antikoerper, 2510049H23Rik antikoerper, AW550643 antikoerper, GLY1 antikoerper, Glo-1 antikoerper, Glo-1r antikoerper, Glo-1s antikoerper, Glo1-r antikoerper, Glo1-s antikoerper, Qglo antikoerper, cb554 antikoerper, zgc:66035 antikoerper, wu:fb82g09 antikoerper, glod1 antikoerper, glyi antikoerper, glo1 antikoerper, GLO1 antikoerper, ATGLX1 antikoerper, F12F1.32 antikoerper, F12F1_32 antikoerper, GLYOXALASE I antikoerper, glyoxalase I homolog antikoerper, trypanothione-dependent glyoxalase I antikoerper, glyoxalase I antikoerper, glyoxalase 1 antikoerper, glyoxalase 1 L homeolog antikoerper, glyoxalase 1 S homeolog antikoerper, lactoylglutathione lyase antikoerper, glyoxalase/bleomycin resistance protein/dioxygenase superfamily protein antikoerper, GLO1 antikoerper, Glo1 antikoerper, glo1 antikoerper, glo1.L antikoerper, glo1.S antikoerper, GST3 antikoerper, GLX1 antikoerper, STY1687 antikoerper, Bcen_2094 antikoerper, gloA antikoerper

Hintergrund: The enzyme encoded by this gene is responsible for the catalysis and formation of S-lactoyl-glutathione from methylglyoxal condensation and reduced glutatione. Glyoxalase I is linked to HLA and is localized to 6p21.3-p21.1, between HLA and the centromere.

Molekulargewicht: 21 kDa (MW of target protein)