IGD1 Antikörper (Middle Region)

Produktnummer ABIN631560

Produktdetails anti-IGD1 Antikörper

Target: IGD1 (IGHD@) (Immunoglobulin Heavy Diversity Cluster (IGHD@))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Applikation: Western Blotting (WB)

Spezifität: TIGD1 antibody was raised against the middle region of TIGD1

Aufreinigung: Affinity purified

Immunogen: TIGD1 antibody was raised using the middle region of TIGD1 corresponding to a region with amino acids SQLMRKASPMSYFRKLPQPPQPSAATTLTSQQPSTSRQDPPPAKRVRLTE

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

TIGD1 Blocking Peptide, catalog no. 33R-8717, is also available for use as a blocking control in assays to test for specificity of this TIGD1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TIGD1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu IGD1

Target: IGD1 (IGHD@) (Immunoglobulin Heavy Diversity Cluster (IGHD@))

Andere Bezeichnung: IGD1

Synonyme: IGH.1@ antikoerper, IGH@ antikoerper, IGHDY1 antikoerper, immunoglobulin heavy locus antikoerper, IGH antikoerper

Hintergrund: TIGD1 belongs to the tigger subfamily of the pogo superfamily of DNA-mediated transposons in humans. These proteins are related to DNA transposons found in fungi and nematodes, and more distantly to the Tc1 and mariner transposases. They are also very similar to the major mammalian centromere protein B. The exact function of this protein is not known.

Molekulargewicht: 67 kDa (MW of target protein)