LOC652618 Antikörper (N-Term)

Produktnummer ABIN631555

Produktdetails anti-LOC652618 Antikörper

Target: LOC652618

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Applikation: Western Blotting (WB)

Spezifität: LOC652618 antibody was raised against the N terminal Of Loc652618

Aufreinigung: Affinity purified

Immunogen: LOC652618 antibody was raised using the N terminal Of Loc652618 corresponding to a region with amino acids MAGRSGHVDVVNERRLKPLYDNLDNGNYKMALQAADKLLKKHKDLHCAKV

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

LOC652618 Blocking Peptide, catalog no. 33R-5668, is also available for use as a blocking control in assays to test for specificity of this LOC652618 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LOC652618 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu LOC652618

Target: LOC652618

Andere Bezeichnung: LOC652618 (LOC652618 Produkte)

Hintergrund: The function of LOC652618 protein has not been widely studied, and is yet to be fully elucidated.

Molekulargewicht: 14 kDa (MW of target protein)