LOC652559 Antikörper (Middle Region)

Produktnummer ABIN631554

Produktdetails anti-LOC652559 Antikörper

Target: LOC652559

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser LOC652559 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: LOC652559 antibody was raised against the middle region of Loc652559

Aufreinigung: Affinity purified

Immunogen: LOC652559 antibody was raised using the middle region of Loc652559 corresponding to a region with amino acids EKSKLGEVDHTLDLVVSFIQEQIVTEEAKSKNSGDAGVDRSLRGPYLARL

Anwendungsinformationen

Applikationshinweise: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

LOC652559 Blocking Peptide, catalog no. 33R-2522, is also available for use as a blocking control in assays to test for specificity of this LOC652559 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LOC652559 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu LOC652559

Target: LOC652559

Andere Bezeichnung: LOC652559 (LOC652559 Produkte)

Hintergrund: The sequence of LOC652559 is derived from an annotated genomic sequence (NW_922352) using gene prediction method: GNOMON. The exact function of LOC652559 remains unknown.

Molekulargewicht: 32 kDa (MW of target protein)