POLQ Antikörper

Produktnummer ABIN631551

Produktdetails anti-POLQ Antikörper

Target: POLQ (Polymerase (DNA Directed), theta (POLQ))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser POLQ Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: POLQ antibody was raised using a synthetic peptide corresponding to a region with amino acids SATNSTSVSSRKAENKYAGGNPVCVRPTPKWQKGIGEFFRLSPKDSEKEN

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

POLQ Blocking Peptide, catalog no. 33R-8319, is also available for use as a blocking control in assays to test for specificity of this POLQ antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of POLQ antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu POLQ

Target: POLQ (Polymerase (DNA Directed), theta (POLQ))

Andere Bezeichnung: POLQ (POLQ Produkte)

Synonyme: POLH antikoerper, PRO0327 antikoerper, A430110D14Rik antikoerper, DNA polymerase theta antikoerper, polymerase (DNA directed), theta antikoerper, POLQ antikoerper, polq antikoerper, LOC100179525 antikoerper, Polq antikoerper

Hintergrund: POLQ belongs to the DNA polymerase type-A family. POLQ could be involved in the repair of interstrand cross-links.

Molekulargewicht: 180 kDa (MW of target protein)