GSTa5 Antikörper (Middle Region)

Produktnummer ABIN631548

Dieser Anti-GSTa5 Antikörper ist ein Kaninchen Polyklonal Antikörper zur Detektion von GSTa5 in WB. Geeignet für Human.

Kurzübersicht für GSTa5 Antikörper (Middle Region) (ABIN631548)

Target: GSTa5 (Glutathione S-Transferase alpha 5 (GSTa5))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser GSTa5 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-GSTa5 Antikörper

Bindungsspezifität: Middle Region

Spezifität: GSTA5 antibody was raised against the middle region of GSTA5

Aufreinigung: Affinity purified

Immunogen: GSTA5 antibody was raised using the middle region of GSTA5 corresponding to a region with amino acids QPEERDAKTALVKEKIKNRYFPAFEKVLKSHRQDYLVGNKLSWADIHLVE

Anwendungsinformationen

Applikationshinweise: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

GSTA5 Blocking Peptide, (ABIN5613889), is also available for use as a blocking control in assays to test for specificity of this GSTA5 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GSTA5 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu GSTa5

Target: GSTa5 (Glutathione S-Transferase alpha 5 (GSTa5))

Andere Bezeichnung: GSTA5

Hintergrund: GSTA5 belongs to the GST superfamily, alpha family. It contains 1 GST C-terminal domain and 1 GST N-terminal domain. The exact functions of GSTA5 remain unknown.

Molekulargewicht: 26 kDa (MW of target protein)