CDYL2 Antikörper (N-Term)

Produktnummer ABIN631545

Produktdetails anti-CDYL2 Antikörper

Target: CDYL2 (Chromodomain Protein, Y-Like 2 (CDYL2))

Bindungsspezifität: N-Term

Reaktivität: Human, Ratte, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CDYL2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: CDYL2 antibody was raised against the N terminal of CDYL2

Aufreinigung: Affinity purified

Immunogen: CDYL2 antibody was raised using the N terminal of CDYL2 corresponding to a region with amino acids NPPLAKPKKGYSGKPSSGGDRATKTVSYRTTPSGLQIMPLKKSQNGMENG

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

CDYL2 Blocking Peptide, catalog no. 33R-6826, is also available for use as a blocking control in assays to test for specificity of this CDYL2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CDYL2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu CDYL2

Target: CDYL2 (Chromodomain Protein, Y-Like 2 (CDYL2))

Andere Bezeichnung: CDYL2 (CDYL2 Produkte)

Synonyme: 1700029M19Rik antikoerper, 4930453I21Rik antikoerper, Gm20194 antikoerper, PCCP1 antikoerper, chromodomain Y-like 2 antikoerper, chromodomain Y like 2 antikoerper, chromodomain protein, Y chromosome-like 2 antikoerper, CDYL2 antikoerper, cdyl2 antikoerper, Cdyl2 antikoerper

Hintergrund: CDYL2 contains 1 chromo domain. The exact function of CDYL2 remains unknown.

Molekulargewicht: 56 kDa (MW of target protein)