TTC16 Antikörper (C-Term)

Produktnummer ABIN631543

Produktdetails anti-TTC16 Antikörper

Target: TTC16 (Tetratricopeptide Repeat Domain 16 (TTC16))

Bindungsspezifität: C-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser TTC16 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: TTC16 antibody was raised against the C terminal of TTC16

Aufreinigung: Affinity purified

Immunogen: TTC16 antibody was raised using the C terminal of TTC16 corresponding to a region with amino acids RSRGLLRSSTKTEAFYDSNWSLSKTEYAQGQGQRSSKAEGAQGKSQGMSS

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

TTC16 Blocking Peptide, catalog no. 33R-8209, is also available for use as a blocking control in assays to test for specificity of this TTC16 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TTC16 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu TTC16

Target: TTC16 (Tetratricopeptide Repeat Domain 16 (TTC16))

Andere Bezeichnung: TTC16 (TTC16 Produkte)

Synonyme: 1200002K10Rik antikoerper, tetratricopeptide repeat domain 16 antikoerper, TTC16 antikoerper, Ttc16 antikoerper

Hintergrund: TTC16 contains 8 TPR repeats. The exact function of TTC16 remains unknown.

Molekulargewicht: 98 kDa (MW of target protein)