PWWP2A Antikörper (C-Term)

Produktnummer ABIN631539

Produktdetails anti-PWWP2A Antikörper

Target: PWWP2A (PWWP Domain Containing 2A (PWWP2A))

Bindungsspezifität: C-Term

Reaktivität: Human, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PWWP2A Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: PWWP2 A antibody was raised against the C terminal of PWWP2

Aufreinigung: Affinity purified

Immunogen: PWWP2 A antibody was raised using the C terminal of PWWP2 corresponding to a region with amino acids PQSRCTSTRSAGLNKWQLLHQTVTSPAAPLQCLTDHCGFRLGALKLTVKR

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PWWP2A Blocking Peptide, catalog no. 33R-7313, is also available for use as a blocking control in assays to test for specificity of this PWWP2A antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PWWP0 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PWWP2A

Target: PWWP2A (PWWP Domain Containing 2A (PWWP2A))

Andere Bezeichnung: PWWP2A (PWWP2A Produkte)

Synonyme: MST101 antikoerper, 4631424J17Rik antikoerper, AI891583 antikoerper, AU024105 antikoerper, D930040F23Rik antikoerper, RGD1305891 antikoerper, PWWP domain containing 2A antikoerper, PWWP2A antikoerper, Pwwp2a antikoerper

Hintergrund: PWWP2A contains 1 PWWP domain. The exact function of PWWP2A remains unknown.

Molekulargewicht: 61 kDa (MW of target protein)