QTRT1 Antikörper

Produktnummer ABIN631538

Produktdetails anti-QTRT1 Antikörper

Target: QTRT1 (Queuine tRNA-Ribosyltransferase 1 (QTRT1))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser QTRT1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: QTRT1 antibody was raised using a synthetic peptide corresponding to a region with amino acids FMPVGTQATMKGITTEQLDALGCRICLGNTYHLGLRPGPELIQKANGLHG

Anwendungsinformationen

Applikationshinweise: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

QTRT1 Blocking Peptide, catalog no. 33R-3000, is also available for use as a blocking control in assays to test for specificity of this QTRT1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of QTRT1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu QTRT1

Target: QTRT1 (Queuine tRNA-Ribosyltransferase 1 (QTRT1))

Andere Bezeichnung: QTRT1 (QTRT1 Produkte)

Synonyme: CG4947 antikoerper, Dmel\\CG4947 antikoerper, TGT antikoerper, tgt antikoerper, zgc:66378 antikoerper, FP3235 antikoerper, TGUT antikoerper, 2610028E17Rik antikoerper, Tgt antikoerper, Tgut antikoerper, tRNA-guanine transglycosylase antikoerper, queuine tRNA-ribosyltransferase 1 S homeolog antikoerper, queuine tRNA-ribosyltransferase 1 antikoerper, queuine tRNA-ribosyltransferase catalytic subunit 1 antikoerper, Tgt antikoerper, Olsu_0732 antikoerper, Palpr_1298 antikoerper, Riean_1227 antikoerper, Calni_1240 antikoerper, Ftrac_0312 antikoerper, Ocepr_1541 antikoerper, Sulku_0977 antikoerper, Tmar_0854 antikoerper, Bache_2323 antikoerper, Nitsa_1291 antikoerper, Isop_1657 antikoerper, Despr_0021 antikoerper, Pedsa_1842 antikoerper, Corgl_1148 antikoerper, Mahau_0921 antikoerper, Theth_0831 antikoerper, qtrt1.S antikoerper, qtrt1 antikoerper, QTRT1 antikoerper, Qtrt1 antikoerper

Hintergrund: TRNA-guanine transglycosylase synthesizes queuosine (Q), which is found in tRNAs that recognise NAU and NAC codons, encoding tyr, asn, asp, and his. Prokaryotic TGT is a single protein of 43 kDa. In contrast, mammalian TGT appears to be a heterodimer consisting of a 60 kDa subunit and a 43 kDa catalytic subunit

Molekulargewicht: 44 kDa (MW of target protein)

Pathways: Ribonucleoside Biosynthetic Process