NSUN3 Antikörper (C-Term)

Produktnummer ABIN631537

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch NSUN3 in WB. Er zeigt eine Reaktivität gegenüber Human und Maus.

Kurzübersicht für NSUN3 Antikörper (C-Term) (ABIN631537)

Target: NSUN3 (NOP2/Sun Domain Family, Member 3 (NSUN3))

Reaktivität: Human, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser NSUN3 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-NSUN3 Antikörper

Bindungsspezifität: C-Term

Spezifität: NSUN3 antibody was raised against the C terminal of NSUN3

Aufreinigung: Affinity purified

Immunogen: NSUN3 antibody was raised using the C terminal of NSUN3 corresponding to a region with amino acids LPLLQIELLRSAIKALRPGGILVYSTCTLSKAENQDVISEILNSHGNIMP

Anwendungsinformationen

Applikationshinweise: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

NSUN3 Blocking Peptide, (ABIN5615068), is also available for use as a blocking control in assays to test for specificity of this NSUN3 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NSUN3 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu NSUN3

Target: NSUN3 (NOP2/Sun Domain Family, Member 3 (NSUN3))

Andere Bezeichnung: NSUN3

Hintergrund: NSUN3 may have S-adenosyl-L-methionine-dependent methyl-transferase activity.

Molekulargewicht: 38 kDa (MW of target protein)