TCP10 Antikörper

Produktnummer ABIN631533

Produktdetails anti-TCP10 Antikörper

Target: TCP10 (T-Complex 10 (TCP10))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser TCP10 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: TCP10 antibody was raised using a synthetic peptide corresponding to a region with amino acids ERINSGKTPPQEDREKSPPGRRQDRSPAPTGRPTPGAERRGVSEDGKIMH

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

TCP10 Blocking Peptide, catalog no. 33R-2697, is also available for use as a blocking control in assays to test for specificity of this TCP10 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TCP10 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu TCP10

Target: TCP10 (T-Complex 10 (TCP10))

Andere Bezeichnung: TCP10 (TCP10 Produkte)

Synonyme: TCP10A antikoerper, t-complex 10 antikoerper, TCP10 antikoerper

Hintergrund: The function of TCP10 protein has not been widely studied, and is yet to be fully elucidated.

Molekulargewicht: 35 kDa (MW of target protein)