NAA30 Antikörper (Middle Region)

Produktnummer ABIN631528

Produktdetails anti-NAA30 Antikörper

Target: NAA30 (N(alpha)-Acetyltransferase 30, NatC Catalytic Subunit (NAA30))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser NAA30 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: NAT12 antibody was raised against the middle region of NAT12

Aufreinigung: Affinity purified

Immunogen: NAT12 antibody was raised using the middle region of NAT12 corresponding to a region with amino acids EQVRLLSSSLTADCSLRSPSGREVEPGEDRTIRYVRYESELQMPDIMRLI

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

NAT12 Blocking Peptide, catalog no. 33R-2683, is also available for use as a blocking control in assays to test for specificity of this NAT12 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NAT12 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu NAA30

Target: NAA30 (N(alpha)-Acetyltransferase 30, NatC Catalytic Subunit (NAA30))

Andere Bezeichnung: NAT12 (NAA30 Produkte)

Synonyme: C14orf35 antikoerper, MAK3 antikoerper, Mak3p antikoerper, NAT12 antikoerper, 4930487N19Rik antikoerper, 5730533P17Rik antikoerper, AI447922 antikoerper, AW322455 antikoerper, Nat12 antikoerper, RGD1559923 antikoerper, mak3 antikoerper, mak3p antikoerper, nat12 antikoerper, N(alpha)-acetyltransferase 30, NatC catalytic subunit antikoerper, N(alpha)-acetyltransferase 30, NatC catalytic subunit S homeolog antikoerper, NAA30 antikoerper, Naa30 antikoerper, naa30.S antikoerper

Hintergrund: NAT12 belongs to the acetyltransferase family, MAK3 subfamily. It contains 1 N-acetyltransferase domain. It is a probable N-acetyltransferase.

Molekulargewicht: 39 kDa (MW of target protein)