DRG1 Antikörper (Middle Region)
-
- Target Alle DRG1 Antikörper anzeigen
- DRG1 (Developmentally Regulated GTP Binding Protein 1 (DRG1))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser DRG1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- DRG1 antibody was raised against the middle region of DRG1
- Aufreinigung
- Affinity purified
- Immunogen
- DRG1 antibody was raised using the middle region of DRG1 corresponding to a region with amino acids VLKPLGHKKIIENELEGFGIRLNSKPPNIGFKKKDKGGINLTATCPQSEL
- Top Product
- Discover our top product DRG1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
DRG1 Blocking Peptide, catalog no. 33R-9670, is also available for use as a blocking control in assays to test for specificity of this DRG1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DRG1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- DRG1 (Developmentally Regulated GTP Binding Protein 1 (DRG1))
- Andere Bezeichnung
- DRG1 (DRG1 Produkte)
- Synonyme
- NEDD3 antikoerper, wu:fb06g12 antikoerper, zgc:64124 antikoerper, xdrg antikoerper, xdrg1 antikoerper, MGC122865 antikoerper, AA408859 antikoerper, AI132520 antikoerper, Nedd3 antikoerper, developmentally regulated GTP binding protein 1 antikoerper, developmentally regulated GTP binding protein 1 L homeolog antikoerper, DRG1 antikoerper, Drg1 antikoerper, drg1 antikoerper, drg1.L antikoerper
- Hintergrund
- DRG1 belongs to the GTP1/OBG family.It may play a role in cell proliferation, differentiation and death.
- Molekulargewicht
- 26 kDa (MW of target protein)
-