DRG1 Antikörper (Middle Region)

Produktnummer ABIN631526

Der Kaninchen Polyklonal anti-DRG1 Antikörper wird verwendet zum Nachweis von DRG1 in Proben von Human, Maus und Ratte. Er wurde validiert für WB.

Kurzübersicht für DRG1 Antikörper (Middle Region) (ABIN631526)

Target: DRG1 (Developmentally Regulated GTP Binding Protein 1 (DRG1))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser DRG1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-DRG1 Antikörper

Bindungsspezifität: Middle Region

Spezifität: DRG1 antibody was raised against the middle region of DRG1

Aufreinigung: Affinity purified

Immunogen: DRG1 antibody was raised using the middle region of DRG1 corresponding to a region with amino acids VLKPLGHKKIIENELEGFGIRLNSKPPNIGFKKKDKGGINLTATCPQSEL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

DRG1 Blocking Peptide, (ABIN5613264), is also available for use as a blocking control in assays to test for specificity of this DRG1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DRG1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu DRG1

Target: DRG1 (Developmentally Regulated GTP Binding Protein 1 (DRG1))

Andere Bezeichnung: DRG1

Hintergrund: DRG1 belongs to the GTP1/OBG family.It may play a role in cell proliferation, differentiation and death.

Molekulargewicht: 26 kDa (MW of target protein)