ACAA1 Antikörper

Produktnummer ABIN631524

Dieser Anti-ACAA1 Antikörper ist ein Kaninchen Polyklonal Antikörper zur Detektion von ACAA1 in WB. Geeignet für Human und Ratte.

Kurzübersicht für ACAA1 Antikörper (ABIN631524)

Target: ACAA1 (Acetyl-CoA Acyltransferase 1 (ACAA1))

Reaktivität: Human, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ACAA1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-ACAA1 Antikörper

Aufreinigung: Affinity purified

Immunogen: ACAA1 antibody was raised using a synthetic peptide corresponding to a region with amino acids ADVVVVHGRRTAICRAGRGGFKDTTPDELLSAVMTAVLKDVNLRPEQLGD

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ACAA1 Blocking Peptide, , is also available for use as a blocking control in assays to test for specificity of this ACAA1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ACAA1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ACAA1

Target: ACAA1 (Acetyl-CoA Acyltransferase 1 (ACAA1))

Andere Bezeichnung: ACAA1

Hintergrund: ACAA1 is an enzyme operative in the beta-oxidation system of the peroxisomes. Deficiency of this enzyme leads to pseudo-Zellweger syndrome.

Molekulargewicht: 44 kDa (MW of target protein)

Pathways: Monocarboxylic Acid Catabolic Process