Cytokeratin 19 Antikörper (N-Term)

Produktnummer ABIN631520

Der Kaninchen Polyklonal Anti-Cytokeratin 19-Antikörper wurde für WB validiert. Er ist geeignet, Cytokeratin 19 in Proben von Human, Maus und Ratte zu detektieren.

Kurzübersicht für Cytokeratin 19 Antikörper (N-Term) (ABIN631520)

Target: Cytokeratin 19 (KRT19) (Keratin 19 (KRT19))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Cytokeratin 19 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-Cytokeratin 19 Antikörper

Bindungsspezifität: N-Term

Spezifität: Cytokeratin 19 antibody was raised against the N terminal of KRT19

Aufreinigung: Affinity purified

Immunogen: Cytokeratin 19 antibody was raised using the N terminal of KRT19 corresponding to a region with amino acids TSYSYRQSSATSSFGGLGGGSVRFGPGVAFRAPSIHGGSGGRGVSVSSAR

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Cytokeratin 19 Blocking Peptide, (ABIN5613106), is also available for use as a blocking control in assays to test for specificity of this Cytokeratin 19 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KRT19 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Cytokeratin 19

Target: Cytokeratin 19 (KRT19) (Keratin 19 (KRT19))

Andere Bezeichnung: Cytokeratin 19

Hintergrund: KRT19 is a member of the keratin family. The keratins are intermediate filament proteins responsible for the structural integrity of epithelial cells and are subdivided into cytokeratins and hair keratins. The type I cytokeratins consist of acidic proteins which are arranged in pairs of heterotypic keratin chains. Unlike its related family members, this smallest known acidic cytokeratin is not paired with a basic cytokeratin in epithelial cells. It is specifically expressed in the periderm, the transiently superficial layer that envelopes the developing epidermis.

Molekulargewicht: 44 kDa (MW of target protein)