DDT Antikörper (N-Term)

Produktnummer ABIN631517

Der Kaninchen Polyklonal Anti-DDT-Antikörper wurde für WB validiert. Er ist geeignet, DDT in Proben von Human zu detektieren.

Kurzübersicht für DDT Antikörper (N-Term) (ABIN631517)

Target: DDT (D-Dopachrome Tautomerase (DDT))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser DDT Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-DDT Antikörper

Bindungsspezifität: N-Term

Spezifität: DDT antibody was raised against the N terminal of DDT

Aufreinigung: Affinity purified

Immunogen: DDT antibody was raised using the N terminal of DDT corresponding to a region with amino acids PFLELDTNLPANRVPAGLEKRLCAAAASILGKPADRVNVTVRPGLAMALS

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

DDT Blocking Peptide, (ABIN5613153), is also available for use as a blocking control in assays to test for specificity of this DDT antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DDT antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu DDT

Target: DDT (D-Dopachrome Tautomerase (DDT))

Andere Bezeichnung: DDT

Hintergrund: D-dopachrome tautomerase converts D-dopachrome into 5,6-dihydroxyindole. It is related to the migration inhibitory factor (MIF) in terms of sequence, enzyme activity, and gene structure. DDT and MIF are closely linked on chromosome 22.D-dopachrome tautomerase converts D-dopachrome into 5,6-dihydroxyindole. The DDT gene is related to the migration inhibitory factor (MIF) in terms of sequence, enzyme activity, and gene structure. DDT and MIF are closely linked on chromosome 22.

Molekulargewicht: 13 kDa (MW of target protein)