SIRT5 Antikörper (Middle Region)

Produktnummer ABIN631515

Der Kaninchen Polyklonal anti-SIRT5 Antikörper (ABIN631515) detektiert spezifisch SIRT5 in WB. Dieser Antikörper reagiert spezifisch mit Proben aus Human.

Kurzübersicht für SIRT5 Antikörper (Middle Region) (ABIN631515)

Target: SIRT5 (Sirtuin 5 (SIRT5))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SIRT5 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-SIRT5 Antikörper

Bindungsspezifität: Middle Region

Spezifität: SIRT5 antibody was raised against the middle region of SIRT5

Aufreinigung: Affinity purified

Immunogen: SIRT5 antibody was raised using the middle region of SIRT5 corresponding to a region with amino acids PICPALSGKGAPEPGTQDASIPVEKLPRCEEAGCGGLLRPHVVWFGENLD

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SIRT5 Blocking Peptide, (ABIN5616160), is also available for use as a blocking control in assays to test for specificity of this SIRT5 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SIRT5 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SIRT5

Target: SIRT5 (Sirtuin 5 (SIRT5))

Andere Bezeichnung: SIRT5

Hintergrund: SIRT5 is included in class III of the sirtuin family which ischaracterized by a sirtuin core domain. Human sirtuins may function as intracellular regulatory proteins with mono-ADP-ribosyltransferase activity. This gene encodes a member of the sirtuin family of proteins, homologs to the yeast Sir2 protein. Members of the sirtuin family are characterized by a sirtuin core domain and grouped into four classes. The functions of human sirtuins have not yet been determined, however, yeast sirtuin proteins are known to regulate epigenetic gene silencing. and suppress recombination of rDNA. Studies suggest that the human sirtuins may function as intracellular regulatory proteins with mono-ADP-ribosyltransferase activity.

Molekulargewicht: 34 kDa (MW of target protein)

Pathways: SARS-CoV-2 Protein Interaktom