POLR1B Antikörper

Produktnummer ABIN631507

Produktdetails anti-POLR1B Antikörper

Target: POLR1B (Polymerase (RNA) I Polypeptide B, 128kDa (POLR1B))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser POLR1B Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: POLR1 B antibody was raised using a synthetic peptide corresponding to a region with amino acids SDKFQVRTTGARDRVTNQPIGGRNVQGGIRFGEMERDALLAHGTSFLLHD

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

POLR1B Blocking Peptide, catalog no. 33R-8358, is also available for use as a blocking control in assays to test for specificity of this POLR1B antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of POLR0 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu POLR1B

Target: POLR1B (Polymerase (RNA) I Polypeptide B, 128kDa (POLR1B))

Andere Bezeichnung: POLR1B (POLR1B Produkte)

Synonyme: RPOL-1l antikoerper, MGC68946 antikoerper, 128kDa antikoerper, D630020H17Rik antikoerper, RPA116 antikoerper, RPA135 antikoerper, RPA2 antikoerper, Rpo1-2 antikoerper, RNA polymerase I subunit B antikoerper, polymerase (RNA) I polypeptide B L homeolog antikoerper, polymerase (RNA) I polypeptide B, 128kDa antikoerper, polymerase (RNA) I polypeptide B antikoerper, DNA-directed RNA polymerase I subunit RPA2 antikoerper, POLR1B antikoerper, polr1b.L antikoerper, polr1b antikoerper, LOC100563266 antikoerper, LOC100634236 antikoerper, Polr1b antikoerper

Hintergrund: Eukaryotic RNA polymerase I (pol I) is responsible for the transcription of ribosomal RNA (rRNA) genes and production of rRNA, the primary component of ribosomes. Pol I is a multisubunit enzyme composed of 6 to 14 polypeptides, depending on the species.

Molekulargewicht: 128 kDa (MW of target protein)