PAOX Antikörper

Produktnummer ABIN631500

Produktdetails anti-PAOX Antikörper

Target: PAOX (Polyamine Oxidase (Exo-N4-Amino) (PAOX))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PAOX Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: PAOX antibody was raised using a synthetic peptide corresponding to a region with amino acids LCLTQVLRRVTGNPRLPAPKSVLRSRWHSAPYTRGSYSYVAVGSTGGDLD

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PAOX Blocking Peptide, catalog no. 33R-4825, is also available for use as a blocking control in assays to test for specificity of this PAOX antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PAOX antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PAOX

Target: PAOX (Polyamine Oxidase (Exo-N4-Amino) (PAOX))

Andere Bezeichnung: PAOX (PAOX Produkte)

Synonyme: PAO antikoerper, mpao1 antikoerper, 2410012F02Rik antikoerper, AI118225 antikoerper, Pao antikoerper, pao antikoerper, polyamine oxidase antikoerper, polyamine oxidase 1 antikoerper, amine oxidase family protein antikoerper, si:dkey-275b16.2 antikoerper, polyamine oxidase (exo-N4-amino) antikoerper, polyamine oxidase (exo-N4-amino) L homeolog antikoerper, PAOX antikoerper, pao1 antikoerper, NFIA_077590 antikoerper, POPTR_0011s12590g antikoerper, si:dkey-275b16.2 antikoerper, Paox antikoerper, paox.L antikoerper

Hintergrund: PAOX belongs to the flavin monoamine oxidase family. PAOX is a flavoenzyme which catalyzes the oxidation of N(1)-acetylspermine to spermidine and is thus involved in the polyamine back-conversion. It can also oxidize N(1)-acetylspermidine to putrescine. PAOX does not oxidize spermidine. It plays an important role in the regulation of polyamine intracellular concentration and has the potential to act as a determinant of cellular sensitivity to the antitumor polyamine analogs.

Molekulargewicht: 25 kDa (MW of target protein)