GID4 Antikörper (C-Term)

Produktnummer ABIN631498

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch GID4 in WB. Er zeigt eine Reaktivität gegenüber Human und Maus.

Kurzübersicht für GID4 Antikörper (C-Term) (ABIN631498)

Target: GID4 (GID Complex Subunit 4, VID24 Homolog (GID4))

Reaktivität: Human, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser GID4 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-GID4 Antikörper

Bindungsspezifität: C-Term

Spezifität: C17 ORF39 antibody was raised against the C terminal Of C17 rf39

Aufreinigung: Affinity purified

Immunogen: C17 ORF39 antibody was raised using the C terminal Of C17 rf39 corresponding to a region with amino acids WDADEDVDRKHWGKFLAFYQYAKSFNSDDFDYEELKNGDYVFMRWKEQFL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

C17ORF39 Blocking Peptide, (ABIN5612425), is also available for use as a blocking control in assays to test for specificity of this C17ORF39 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C10 RF39 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu GID4

Target: GID4 (GID Complex Subunit 4, VID24 Homolog (GID4))

Andere Bezeichnung: C17ORF39

Hintergrund: The function of C17orf39 protein has not been widely studied, and is yet to be fully elucidated. The multiprotein Mediator complex is a coactivator required for activation of RNA polymerase II transcription by DNA bound transcription factors.

Molekulargewicht: 33 kDa (MW of target protein)